Loading...
Statistics
Advertisement

Thetacoeur.com

Advertisement
Conversion Technology Metas Server
Thetacoeur.com is hosted in Australia . Thetacoeur.com uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Thetacoeur.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Thetacoeur.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=Hosted by Hitech United Australia/OU=COMODO SSL Wildcard/CN=*.hostingbay.net
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: Hosted by Hitech United Australia
        • 2: COMODO SSL Wildcard
      • CN: *.hostingbay.net
    • hash: f8d00007
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 66661801779157772943395541328830322176
    • validFrom: 151217000000Z
    • validTo: 170816235959Z
    • validFrom_time_t: 1450310400
    • validTo_time_t: 1502927999
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 13:6A:B2:E3:61:94:70:3E:2B:4B:B1:BD:02:FF:F7:58:B8:0D:84:6E
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.hostingbay.net, DNS:hostingbay.net

Meta - Thetacoeur.com

Number of occurences: 1
  • Name:
    Content: 0;URL=/cgi-sys/defaultwebpage.cgi

Server / Hosting

  • IP: 203.143.86.244
  • Latitude: -33.49
  • Longitude: 143.21
  • Country: Australia

Rname

  • ns2.hostingbay.net
  • ns1.hostingbay.net
  • ns3.hostingbay.net
  • thetacoeur.com

Target

  • serveradmin.esolute.com

HTTP Header Response

HTTP/1.1 200 OK Date: Sun, 10 Apr 2016 08:37:21 GMT Server: Apache Last-Modified: Mon, 28 Sep 2015 15:07:09 GMT Accept-Ranges: bytes Content-Length: 111 Content-Type: text/html

DNS

host: thetacoeur.com
  1. class: IN
  2. ttl: 14399
  3. type: A
  4. ip: 203.143.86.244
host: thetacoeur.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns2.hostingbay.net
host: thetacoeur.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns1.hostingbay.net
host: thetacoeur.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns3.hostingbay.net
host: thetacoeur.com
  1. class: IN
  2. ttl: 14400
  3. type: SOA
  4. mname: ns1.hostingbay.net
  5. rname: serveradmin.esolute.com
  6. serial: 2015060805
  7. refresh: 3600
  8. retry: 7200
  9. expire: 1280000
  10. minimum-ttl: 43200
host: thetacoeur.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: thetacoeur.com
host: thetacoeur.com
  1. class: IN
  2. ttl: 14400
  3. type: TXT
  4. txt: v=spf1 ip4:116.240.195.89 ip4:116.240.195.44 ip4:116.240.195.31 a mx ptr ~all
  5. entries: Array

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.hetacoeur.com, www.tqhetacoeur.com, www.qhetacoeur.com, www.tahetacoeur.com, www.ahetacoeur.com, www.t hetacoeur.com, www. hetacoeur.com, www.twhetacoeur.com, www.whetacoeur.com, www.tehetacoeur.com, www.ehetacoeur.com, www.tzhetacoeur.com, www.zhetacoeur.com, www.txhetacoeur.com, www.xhetacoeur.com, www.tchetacoeur.com, www.chetacoeur.com, www.tetacoeur.com, www.theetacoeur.com, www.teetacoeur.com, www.thdetacoeur.com, www.tdetacoeur.com, www.thcetacoeur.com, www.tcetacoeur.com, www.thuetacoeur.com, www.tuetacoeur.com, www.thjetacoeur.com, www.tjetacoeur.com, www.thetacoeur.com, www.tetacoeur.com, www.thbetacoeur.com, www.tbetacoeur.com, www.thgetacoeur.com, www.tgetacoeur.com, www.thtacoeur.com, www.thextacoeur.com, www.thxtacoeur.com, www.thestacoeur.com, www.thstacoeur.com, www.thewtacoeur.com, www.thwtacoeur.com, www.thertacoeur.com, www.thrtacoeur.com, www.theftacoeur.com, www.thftacoeur.com, www.thevtacoeur.com, www.thvtacoeur.com, www.thectacoeur.com, www.thctacoeur.com, www.theqtacoeur.com, www.thqtacoeur.com, www.theatacoeur.com, www.thatacoeur.com, www.theytacoeur.com, www.thytacoeur.com, www.theacoeur.com, www.thetqacoeur.com, www.theqacoeur.com, www.thetaacoeur.com, www.theaacoeur.com, www.thet acoeur.com, www.the acoeur.com, www.thetwacoeur.com, www.thewacoeur.com, www.theteacoeur.com, www.theeacoeur.com, www.thetzacoeur.com, www.thezacoeur.com, www.thetxacoeur.com, www.thexacoeur.com, www.thetcacoeur.com, www.thecacoeur.com, www.thetcoeur.com, www.thetaocoeur.com, www.thetocoeur.com, www.thetapcoeur.com, www.thetpcoeur.com, www.theta9coeur.com, www.thet9coeur.com, www.thetacoeur.com, www.thetcoeur.com, www.thetaicoeur.com, www.theticoeur.com, www.thetaucoeur.com, www.thetucoeur.com, www.thetaoeur.com, www.thetacdoeur.com, www.thetadoeur.com, www.thetacroeur.com, www.thetaroeur.com, www.thetactoeur.com, www.thetatoeur.com, www.thetacvoeur.com, www.thetavoeur.com, www.thetacfoeur.com, www.thetafoeur.com, www.thetacgoeur.com, www.thetagoeur.com, www.thetachoeur.com, www.thetahoeur.com, www.thetacnoeur.com, www.thetanoeur.com, www.thetacmoeur.com, www.thetamoeur.com, www.thetacjoeur.com, www.thetajoeur.com, www.thetaceur.com, www.thetacobeur.com, www.thetacbeur.com, www.thetacoheur.com, www.thetacheur.com, www.thetacogeur.com, www.thetacgeur.com, www.thetacojeur.com, www.thetacjeur.com, www.thetacomeur.com, www.thetacmeur.com, www.thetaco eur.com, www.thetac eur.com, www.thetacoveur.com, www.thetacveur.com, www.thetacour.com, www.thetacoexur.com, www.thetacoxur.com, www.thetacoesur.com, www.thetacosur.com, www.thetacoewur.com, www.thetacowur.com, www.thetacoerur.com, www.thetacorur.com, www.thetacoefur.com, www.thetacofur.com, www.thetacoevur.com, www.thetacovur.com, www.thetacoecur.com, www.thetacocur.com, www.thetacoequr.com, www.thetacoqur.com, www.thetacoeaur.com, www.thetacoaur.com, www.thetacoeyur.com, www.thetacoyur.com, www.thetacoer.com, www.thetacoeuwr.com, www.thetacoewr.com, www.thetacoeuer.com, www.thetacoeer.com, www.thetacoeusr.com, www.thetacoesr.com, www.thetacoeuar.com, www.thetacoear.com, www.thetacoeu.com, www.thetacoeuri.com, www.thetacoeui.com, www.thetacoeuro.com, www.thetacoeuo.com, www.thetacoeurl.com, www.thetacoeul.com, www.thetacoeurl.com, www.thetacoeul.com, www.thetacoeur..com, www.thetacoeu..com,

Other websites we recently analyzed

  1. christsmercychurch.com
    The official webpage of Christ's Mercy Church in Katy, Texas. Find out about who we are and what we do, as well as sermons and discipleship lessons.
    New York (United States) - 198.185.159.144
    Server software:
    Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Squarespace
    Number of Javascript: 2
    Number of meta tags: 7
  2. smallkitchenappliancesreview.com
    Virgin Islands, British - 208.91.197.13
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  3. Bellingham Dental Group – Dentist in Bellingham, WA - Dentist Bellingham WA with Dr. Parker Haley
    Bellingham Dentist Dr. Parker Haley leads Bellingham Dental Group, offering a range of dental services including student & emergency services. 360-734-6190
    Scottsdale (United States) - 50.62.89.138
    G Analytics ID: UA-42878548-1
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Google Font API, Html, Javascript, jQuery, jQuery Cycle, jQuery UI, Php, Pingback, Google Analytics, Wordpress, Google +1 Button
    Number of Javascript: 13
    Number of meta tags: 5
  4. Home
    My Joomla CMS
    Australia - 221.121.144.145
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, SuperFish, Joomla
    Number of Javascript: 15
    Number of meta tags: 3
  5. ylvx.net
    Ottawa (Canada) - 47.90.20.17
    Server software: Microsoft-IIS/7.5
    Technology: Html, Php
    Number of Javascript: 1
    Number of meta tags: 1
  6. beorc.com
    Wayne (United States) - 74.208.84.115
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  7. Changeist: Futures, Innovation, Strategic Design
    Changeist is a post-national research, consulting and creative group focused on strategic innovation for the future.
    New York (United States) - 198.49.23.145
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Google Analytics, Squarespace
    Number of Javascript: 2
    Number of meta tags: 7
  8. Susie Wong Bar & Restaurant - Windsor
    Susie Wong Bar & Restaurant - 12 Chapel St Windsor, VIC - 03 9510 1875 - OPENING HOURS Tue | Wed | Thur 6pm-late Fri | Sat | Sun 12-3pm & 6pm-late
    Adelaide (Australia) - 175.107.184.169
    Server software: Apache
    Technology: CSS, Html
    Number of Javascript: 4
    Number of meta tags: 3
  9. Herzlich Willkommen!
    Germany - 78.46.84.82
    Server software: nginx
    Technology: CSS, Html
    Number of meta tags: 2
  10. מכונות כביסה ומייבשים להשכרה – קלינומט החזקות
    קלינומט אחזקות משכירה מכונות כביסה ומכונות ייבוש למוסדות ולגופים שונים. המכונות מופעלות באמצעים טכנולוגיים פשוטים המותאמים לדרישות הלקוח. באתר ניתן למצוא מידע אודות החברה, הציוד, השירות הניתן וטופס ליצירת קשר.
    Israel - 212.199.115.180
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 7
    Number of meta tags: 5

Check Other Websites